PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG319600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 24363.6 Da    PI: 8.9003
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG319600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF854.5e-271059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsst +lyeyss
  Pavir.1NG319600.1.p 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTSRLYEYSS 59
                         8***********************************************96 PP

2K-box66.11.3e-22711511699
                K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                          + ++e + + + +++L+ +   l+GedL+ L++keLq+Le+qLe+sl+ +RskK++ll+++i+el +k    ++en++L +k++
  Pavir.1NG319600.1.p  71 KAKEEQQVVANPNSELKGQ---LMGEDLSGLNVKELQSLENQLETSLRGVRSKKDHLLIDEIHELNRKASLFHQENMDLYNKIN 151
                          5556666666666666665...**********************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.034161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-37160IPR002100Transcription factor, MADS-box
CDDcd002651.57E-43277No hitNo description
SuperFamilySSF554559.94E-32283IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003195.7E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.66855156IPR002487Transcription factor, K-box
PfamPF014863.8E-2088150IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLMIFSS TSRLYEYSST  60
SMKSVIDRYG KAKEEQQVVA NPNSELKGQL MGEDLSGLNV KELQSLENQL ETSLRGVRSK  120
KDHLLIDEIH ELNRKASLFH QENMDLYNKI NQIRQENAEL YKKIYQTEGP SEVNRESSTP  180
YNFAVVENTD VPVQLGLSTL PQQNNIEPST APKLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-20183183Myocyte-specific enhancer factor 2B
1tqe_Q5e-20183183Myocyte-specific enhancer factor 2B
1tqe_R5e-20183183Myocyte-specific enhancer factor 2B
1tqe_S5e-20183183Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1121491e-105AF112149.1 Zea mays MADS box protein 2 (mads2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952891.11e-144PREDICTED: MADS-box transcription factor 27
SwissprotQ6EP491e-134MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLQ9FVN11e-137Q9FVN1_MAIZE; MADS box protein 2
STRINGBGIOSGA008494-PA1e-132(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.28e-77AGAMOUS-like 16